RYK, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-383	50 μL

Catalog No. 89-105-383 Supplier Abnova Corporation Supplier No. H00006259A01

Description

Mouse polyclonal antibody raised against a partial recombinant RYK.

The protein encoded by this gene is an atypical member of the family of growth factor receptor protein tyrosine kinases, differing from other members at a number of conserved residues in the activation and nucleotide binding domains. This gene product belongs to a subfamily whose members do not appear to be regulated by phosphorylation in the activation segment. It has been suggested that mediation of biological activity by recruitment of a signaling-competent auxiliary protein may occur through an as yet uncharacterized mechanism. Two alternative splice variants have been identified, encoding distinct isoforms. [provided by RefSeq

Sequence: ELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRNDLISHYALSFNLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQVNISVQGEVPRTLSVFRVELSCTGKV

Specifications

• Antigen: RYK
• Applications: ELISA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RYK.
• Formulation: 50% glycerol
• Gene: RYK
• Gene Accession No.: NM_002958
• Gene Alias: D3S3195/JTK5/JTK5A/RYK1
• Gene Symbols: RYK
• Host Species: Mouse
• Immunogen: RYK (NP_002949, 54 a.a. ∽ 163 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6259
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only