S100A2, Mouse, Clone: 3H8, Abnova™

Catalog No.	Quantity
89-105-385	200 μL

Catalog No. 89-105-385 Supplier Abnova Corporation Supplier No. H00006273M03A

Description

Mouse monoclonal antibody raised against a full-length recombinant S100A2.

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may have a tumor suppressor function. Chromosomal rearrangements and altered expression of this gene have been implicated in breast cancer. [provided by RefSeq

Sequence: MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP

Specifications

• Antigen: S100A2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3H8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant S100A2.
• Formulation: ascites with no preservative
• Gene: S100A2
• Gene Accession No.: BC002829
• Gene Alias: CAN19/MGC111539/S100L
• Gene Symbols: S100A2
• Host Species: Mouse
• Immunogen: S100A2 (AAH02829,1 a.a. ∽ 97 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6273
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2b κ