S100A6, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-388	50 μL

Catalog No. 89-105-388 Supplier Abnova Corporation Supplier No. H00006277A01

Description

Mouse polyclonal antibody raised against a partial recombinant S100A6.

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma. [provided by RefSeq]

Sequence: KYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYSEALKG

Specifications

• Antigen: S100A6
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant S100A6.
• Formulation: 50% glycerol
• Gene: S100A6
• Gene Accession No.: NM_014624
• Gene Alias: 2A9/5B10/CABP/CACY/PRA
• Gene Symbols: S100A6
• Host Species: Mouse
• Immunogen: S100A6 (NP_055439, 18 a.a. ∽ 90 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6277
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only