S100A7, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-389	50 μL

Catalog No. 89-105-389 Supplier Abnova Corporation Supplier No. H00006278A01

Description

Mouse polyclonal antibody raised against a full-length recombinant S100A7.

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. This protein is markedly over-expressed in the skin lesions of psoriatic patients, but is excluded as a candidate gene for familial psoriasis susceptibility. The exact function of this protein is not known. [provided by RefSeq

Sequence: MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ

Specifications

• Antigen: S100A7
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length recombinant S100A7.
• Formulation: 50% glycerol
• Gene: S100A7
• Gene Accession No.: BC034687.1
• Gene Alias: PSOR1/S100A7c
• Gene Symbols: S100A7
• Host Species: Mouse
• Immunogen: S100A7 (AAH34687.1, 1 a.a. ∽ 101 a.a) full-length recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6278
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only