S100A9, Mouse, Clone: 1C10, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant S100A9.

Supplier:  Abnova Corporation H00006280M01A

Catalog No. 89-105-392

Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. [provided by RefSeq

Sequence: MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENRNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Specifications

• Antigen: S100A9
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC047681
• Gene Symbols: S100A9
• Immunogen: S100A9 (AAH47681,1 a.a. ∽ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 6280
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 1C10
• Description: Mouse monoclonal antibody raised against a full length recombinant S100A9.
• Gene: S100A9
• Gene Alias: 60B8AG/CAGB/CFAG/CGLB/L1AG/LIAG/MAC387/MIF/MRP14/NIF/P14
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG