S100P, Mouse, Clone: 4E7, Abnova™

Catalog No.	Quantity
89-105-397	200 μL

Catalog No. 89-105-397 Supplier Abnova Corporation Supplier No. H00006286M02A

Description

Mouse monoclonal antibody raised against a full-length recombinant S100P.

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer. [provided by RefSeq]

Sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK

Specifications

• Antigen: S100P
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4E7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant S100P.
• Formulation: ascites with no preservative
• Gene: S100P
• Gene Accession No.: BC006819
• Gene Alias: MIG9
• Gene Symbols: S100P
• Host Species: Mouse
• Immunogen: S100P (AAH06819,1 a.a. ∽ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6286
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2b κ