SCARB2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SCARB2.

Supplier:  Abnova Corporation H00000950A01

Catalog No. 89-104-226

Description

The protein encoded by this gene is a type III glycoprotein that is located primarily in limiting membranes of lysosomes and endosomes. Studies of the similar protein in mice and rat suggested that this protein may participate in membrane transportation and the reorganization of endosomal/lysosomal compartment. Deficiency of the similar protein in mice was reported to impair cell membrane transport processes and cause pelvic junction obstruction, deafness, and peripheral neuropathy. [provided by RefSeq

Sequence: FPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTLIITN

Specifications

• Antigen: SCARB2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant SCARB2.
• Gene: SCARB2
• Gene Alias: AMRF/CD36L2/HLGP85/LIMPII/SR-BII
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_005506
• Gene Symbols: SCARB2
• Immunogen: SCARB2 (NP_005497, 339 a.a. ∽ 437 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 950
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only