SCD, Mouse, Clone: 1B7, Abnova™

Catalog No.	Quantity
89-105-404	200 μL

Catalog No. 89-105-404 Supplier Abnova Corporation Supplier No. H00006319M02A

Description

Mouse monoclonal antibody raised against a partial recombinant SCD.

Stearoyl-CoA desaturase (SCD; EC 1.14.99.5) is an iron-containing enzyme that catalyzes a rate-limiting step in the synthesis of unsaturated fatty acids. The principal product of SCD is oleic acid, which is formed by desaturation of stearic acid. The ratio of stearic acid to oleic acid has been implicated in the regulation of cell growth and differentiation through effects on cell membrane fluidity and signal transduction. Four SCD isoforms, Scd1 through Scd4, have been identified in mouse. In contrast, only 2 SCD isoforms, SCD1 and SCD5 (MIM 608370), have been identified in human. SCD1 shares about 85% amino acid identity with all 4 mouse SCD isoforms, as well as with rat Scd1 and Scd2. In contrast, SCD5 shares limited homology with the rodent SCDs and appears to be unique to primates (Zhang et al. (1999) [PubMed 10229681]; Wang et al., 2005 [PubMed 15907797]).[supplied by OMIM

Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYVWRNIILMSLLHLGALYGITLIPTCKFYT

Specifications

• Antigen: SCD
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1B7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SCD.
• Formulation: ascites with no preservative
• Gene: SCD
• Gene Accession No.: NM_005063.4
• Gene Alias: FADS5/MSTP008/SCD1
• Gene Symbols: SCD
• Host Species: Mouse
• Immunogen: SCD (NP_005054.3,1 a.a. ∽ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6319
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ