SCN2A2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-407	50 μL

Catalog No. 89-105-407 Supplier Abnova Corporation Supplier No. H00006326A01

Description

Mouse polyclonal antibody raised against a partial recombinant SCN2A2.

Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit with 24 transmembrane domains and one or more regulatory beta subunits. They are responsible for the generation and propagation of action potentials in neurons and muscle. This gene encodes one member of the sodium channel alpha subunit gene family. It is heterogeneously expressed in the brain, and mutations in this gene have been linked to several seizure disorders. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq

Sequence: NLRNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNPNY

Specifications

• Antigen: SCN2A2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SCN2A2.
• Formulation: 50% glycerol
• Gene: SCN2A
• Gene Accession No.: NM_021007
• Gene Alias: HBA/HBSCI/HBSCII/NAC2/Na(v)1.2/Nav1.2/SCN2A1/SCN2A2
• Gene Symbols: SCN2A
• Host Species: Mouse
• Immunogen: SCN2A2 (NP_066287, 273 a.a. ∽ 362 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6326
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only