SEP15, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-077	50 μL

Catalog No. 89-106-077 Supplier Abnova Corporation Supplier No. H00009403A01

Description

Mouse polyclonal antibody raised against a partial recombinant SEP15.

This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Studies in mouse suggest that this selenoprotein may have redox function and may be involved in the quality control of protein folding. This gene is localized on chromosome 1p31, a genetic locus commonly mutated or deleted in human cancers. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Sequence: KLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLERI

Specifications

• Antigen: SEP15.
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SEP15.
• Formulation: 50% glycerol
• Gene: SEP15
• Gene Accession No.: NM_004261
• Gene Symbols: SEP15
• Host Species: Mouse
• Immunogen: SEP15 (NP_004252, 97 a.a. ∽ 165 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9403
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only