SETDB1, Mouse, Clone: 4E8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SETDB1.

Supplier:  Abnova Corporation H00009869M22A

Catalog No. 89-106-166

Description

This gene encodes a histone methyltransferase. The encoded enzyme catalyzes the reaction of S-adenosyl-L-methionine and histone L-lysine to produce S-adenosyl-L-homocysteine and histone N(6)-methyl-L-lysine. The encoded protein likely functions in transcriptional repression. Alternatively spliced transcript variants have been described

Sequence: SSLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCVQQRKKQLAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFY

Specifications

• Antigen: SETDB1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_012432
• Gene Symbols: SETDB1
• Immunogen: SETDB1 (NP_036564,2 a.a. ∽ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 9869
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 4E8
• Description: Mouse monoclonal antibody raised against a partial recombinant SETDB1.
• Gene: SETDB1
• Gene Alias: ESET/KG1T/KIAA0067/KMT1E
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ