Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89107415

SETDB2, Mouse, Clone: 1E2, Abnova™

Catalog No. 89107415 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-107-415 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-107-415 Supplier Abnova Corporation Supplier No. H00083852M07A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant SETDB2.

Proteins that contain a SET domain, such as SETDB2, modulate gene expression epigenetically through histone H3 (see MIM 601128) methylation. SETDB2 is likely a histone H3 methyltransferase, as it contains both the active site and flanking cysteine residues required for catalytic activity (Zhang et al., 2003 [PubMed 12754510]).[supplied by OMIM

Sequence: KNTSSDSLTKFNKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAGTVPEKEIFCQCGVNKCRKKIL

Specifications

Antigen SETDB2
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1E2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SETDB2.
Formulation ascites with no preservative
Gene SETDB2
Gene Accession No. NM_031915
Gene Alias C13orf4/CLLD8/CLLL8/DKFZp586I0123/DKFZp761J1217/KMT1F
Gene Symbols SETDB2
Host Species Mouse
Immunogen SETDB2 (NP_114121.1,620 a.a. ∽ 719 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 83852
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.