SF3A1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-276	50 μL

Catalog No. 89-106-276 Supplier Abnova Corporation Supplier No. H00010291A01

Description

Mouse polyclonal antibody raised against a partial recombinant SF3A1.

This gene encodes subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family; named for the SURP (also called SWAP or Suppressor-of-White-APricot) motifs that are thought to mediate RNA binding. Subunit 1 has tandemly repeated SURP motifs in its amino-terminal half while its carboxy-terminal half contains a proline-rich region and a ubiquitin-like domain. Binding studies with truncated subunit 1 derivatives demonstrated that the two SURP motifs are necessary for binding to subunit 3 while contacts with subunit 2 may occur through sequences carboxy-terminal to the SURP motifs. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: TIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFS

Specifications

• Antigen: SF3A1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SF3A1.
• Formulation: 50% glycerol
• Gene: SF3A1
• Gene Accession No.: NM_005877
• Gene Alias: PRP21/PRPF21/SAP114/SF3A120
• Gene Symbols: SF3A1
• Host Species: Mouse
• Immunogen: SF3A1 (NP_005868, 140 a.a. ∽ 227 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10291
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only