SFTPB, Mouse, Clone: 2H6, Abnova™

Catalog No.	Quantity
89-105-435	100 μg

Catalog No. 89-105-435 Supplier Abnova Corporation Supplier No. H00006439M02

Description

Mouse monoclonal antibody raised against a full-length recombinant SFTPB.

The SFTPB gene encodes the pulmonary-associated surfactant B protein (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Surfactant is composed of phospholipids and other surfactant-associated proteins (Clark et al., 1995 [PubMed 7644495]). See also SFTPA1 (MIM 178630), SFTPC (MIM 178620), and SFTPD (MIM 178635).[supplied by OMIM

Sequence: MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL

Specifications

• Antigen: SFTPB
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2H6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant SFTPB.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SFTPB
• Gene Accession No.: NM_000542.2
• Gene Alias: PSP-B/SFTB3/SFTP3/SMDP1/SP-B
• Gene Symbols: SFTPB
• Host Species: Mouse
• Immunogen: SFTPB (NP_000533.2,1 a.a. ∽ 381 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Protein A Purification
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6439
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG2a κ