SGK1, Mouse, Clone: 4D7-G3, Abnova™

Catalog No.	Quantity
89-105-440	200 μL

Catalog No. 89-105-440 Supplier Abnova Corporation Supplier No. H00006446M01A

Description

Mouse monoclonal antibody raised against a full-length recombinant SGK1.

This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq

Sequence: MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL

Specifications

• Antigen: SGK1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4D7-G3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant SGK1.
• Formulation: ascites with no preservative
• Gene: SGK1
• Gene Accession No.: BC001263
• Gene Alias: SGK
• Gene Symbols: SGK1
• Host Species: Mouse
• Immunogen: SGK1 (AAH01263.1,1 a.a. ∽ 431 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6446
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ