SHANK2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-539	50 μL

Catalog No. 89-106-539 Supplier Abnova Corporation Supplier No. H00022941A01

Description

Mouse polyclonal antibody raised against a partial recombinant SHANK2.

This gene encodes a protein that is a member of the Shank family of synaptic proteins that may function as molecular scaffolds in the postsynaptic density (PSD). Shank proteins contain multiple domains for protein-protein interaction, including ankyrin repeats, an SH3 domain, a PSD-95/Dlg/ZO-1 domain, a sterile alpha motif domain, and a proline-rich region. This particular family member contains a PDZ domain, a consensus sequence for cortactin SH3 domain-binding peptides and a sterile alpha motif. The alternative splicing demonstrated in Shank genes has been suggested as a mechanism for regulating the molecular structure of Shank and the spectrum of Shank-interacting proteins in the PSDs of adult and developing brain. Two alternative splice variants, encoding distinct isoforms, are reported. Additional splice variants exist but their full-length nature has not been determined. [provided by RefSeq

Sequence: SILQQMNREKLAKPGEGLDSPMGAKSASLAPRSPEIMSTISGTRSTTVTFTVRPGTSQPITLQSRPPDYESRTSGTRRAPSPVVSPTEMNK

Specifications

• Antigen: SHANK2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SHANK2.
• Formulation: 50% glycerol
• Gene: SHANK2
• Gene Accession No.: NM_012309
• Gene Alias: CORTBP1/CTTNBP1/ProSAP1/SHANK/SPANK-3
• Gene Symbols: SHANK2
• Host Species: Mouse
• Immunogen: SHANK2 (NP_036441, 1034 a.a. ∽ 1124 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 22941
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only