SHOX2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-445	50 μL

Catalog No. 89-105-445 Supplier Abnova Corporation Supplier No. H00006474A01

Description

Mouse polyclonal antibody raised against a partial recombinant SHOX2.

This gene is a member of the homeobox family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeobox genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeobox genes. This locus represents a pseudoautosomal homeobox gene that is thought to be responsible for idiopathic short stature, and it is implicated in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK

Specifications

• Antigen: SHOX2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SHOX2.
• Formulation: 50% glycerol
• Gene: SHOX2
• Gene Accession No.: NM_006884
• Gene Alias: OG12/OG12X/OGI2X/SHOT
• Gene Symbols: SHOX2
• Host Species: Mouse
• Immunogen: SHOX2 (NP_006875, 117 a.a. ∽ 204 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6474
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only