SKIV2L, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-449	50 μL

Catalog No. 89-105-449 Supplier Abnova Corporation Supplier No. H00006499A01

Description

Mouse polyclonal antibody raised against a partial recombinant SKIV2L.

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a human homologue of yeast SKI2 and may be involved in antiviral activity by blocking translation of poly(A) deficient mRNAs. This gene is located in the class III region of the major histocompatibility complex. [provided by RefSeq

Sequence: DQLPNTLKQGIERVRAVAKRIGEVQVACGLNQTVEEFVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLL

Specifications

• Antigen: SKIV2L
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SKIV2L.
• Formulation: 50% glycerol
• Gene: SKIV2L
• Gene Accession No.: NM_006929
• Gene Alias: 170A/DDX13/HLP/SKI2/SKI2W/SKIV2
• Gene Symbols: SKIV2L
• Host Species: Mouse
• Immunogen: SKIV2L (NP_008860, 1125 a.a. ∽ 1233 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6499
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only