SKP1A, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-451	50 μL

Catalog No. 89-105-451 Supplier Abnova Corporation Supplier No. H00006500A01

Description

Mouse polyclonal antibody raised against a full-length recombinant SKP1A.

This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq]

Sequence: MPSIKLQSFDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL

Specifications

• Antigen: SKP1A
• Applications: ELISA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length recombinant SKP1A.
• Formulation: 50% glycerol
• Gene: SKP1
• Gene Accession No.: BC025673
• Gene Alias: EMC19/MGC34403/OCP-II/OCP2/SKP1A/TCEB1L/p19A
• Gene Symbols: SKP1
• Host Species: Mouse
• Immunogen: SKP1A (AAH25673, 1 a.a. ∽ 160 a.a) full-length recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6500
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only