SLC12A6, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SLC12A6.

Supplier:  Abnova Corporation H00009990A01

Catalog No. 89-106-188

Description

This gene is a member of the K-Cl cotransporter (KCC) family. K-Cl cotransporters are integral membrane proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential. The proteins encoded by this gene are activated by cell swelling induced by hypotonic conditions. Alternate splicing results in multiple transcript variants encoding different isoforms. Mutations in this gene are associated with agenesis of the corpus callosum with peripheral neuropathy. [provided by RefSeq

Sequence: MPHFTVTKVEDPEEGAAASISQEPSLADIKARIQDSDEPDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMD

Specifications

• Antigen: SLC12A6
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant SLC12A6.
• Gene: SLC12A6
• Gene Alias: ACCPN/DKFZp434D2135/KCC3/KCC3A/KCC3B
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_005135
• Gene Symbols: SLC12A6
• Immunogen: SLC12A6 (NP_005126, 1 a.a. ∽ 90 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 9990
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only