SLC1A2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-454	50 μL

Catalog No. 89-105-454 Supplier Abnova Corporation Supplier No. H00006506A01

Description

Mouse polyclonal antibody raised against a partial recombinant SLC1A2.

This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq

Sequence: DEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDG

Specifications

• Antigen: SLC1A2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SLC1A2.
• Formulation: 50% glycerol
• Gene: SLC1A2
• Gene Accession No.: NM_004171
• Gene Alias: EAAT2/GLT-1
• Gene Symbols: SLC1A2
• Host Species: Mouse
• Immunogen: SLC1A2 (NP_004162, 160 a.a. ∽ 239 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6506
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only