SLC1A3, Mouse, Clone: 3D1, Abnova™

Catalog No.	Quantity
89-105-455	200 μL

Catalog No. 89-105-455 Supplier Abnova Corporation Supplier No. H00006507M07A

Description

Mouse monoclonal antibody raised against a partial recombinant SLC1A3.

Glutamate and aspartate are excitatory neurotransmitters that have been implicated in a number of pathologic states of the nervous system. Accumulation of extracellular excitatory amino acids can be cytotoxic and may also lower the seizure threshold in epilepsy. EAAT1 (SLC1A3) is a member of a family of high-affinity sodium-dependent transporter molecules that regulate neurotransmitter concentrations at the excitatory glutamatergic synapses of the mammalian central nervous system (Kirschner et al., 1994 [PubMed 8001975]).[supplied by OMIM

Sequence: VRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGS

Specifications

• Antigen: SLC1A3
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3D1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SLC1A3.
• Formulation: ascites with no preservative
• Gene: SLC1A3
• Gene Accession No.: NM_004172
• Gene Alias: EA6/EAAT1/FLJ25094/GLAST/GLAST1
• Gene Symbols: SLC1A3
• Host Species: Mouse
• Immunogen: SLC1A3 (NP_004163.2,162 a.a. ∽ 237 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6507
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ