Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89105458

SLC3A1, Mouse, Clone: 2F2, Abnova™

Catalog No. 89105458 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-458 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-458 Supplier Abnova Corporation Supplier No. H00006519M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant SLC3A1.

This gene encodes a type II membrane glycoprotein which is one of the components of the renal amino acid transporter which transports neutral and basic amino acids in the renal tubule and intestinal tract. Mutations and deletions in this gene are associated with cystinuria. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq

Sequence: FIPNHTSDKHIWFQLSRTRTGKYTDYYIWHDCTHENGKTIPPNNWLSVYGNSSWHFDEVRNQCYFHQFMKEQPDLNFRNPDVQEEIKEILRFWLTKGVDGFSLDAVKFLL

Specifications

Antigen SLC3A1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2F2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SLC3A1.
Formulation ascites with no preservative
Gene SLC3A1
Gene Accession No. BC022386
Gene Alias ATR1/CSNU1/D2H/FLJ34681/NBAT/RBAT
Gene Symbols SLC3A1
Host Species Mouse
Immunogen SLC3A1 (AAH22386,211 a.a. ∽ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6519
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.