SLC4A4, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SLC4A4.

Supplier:  Abnova Corporation H00008671A01

Catalog No. 89-105-913

Description

This gene encodes a sodium bicarbonate cotransporter (NBC) involved in the regulation of bicarbonate secretion and absorption and intracellular pH. Mutations in this gene are associated with proximal renal tubular acidosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPELKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNK

Specifications

• Antigen: SLC4A4
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant SLC4A4.
• Gene: SLC4A4
• Gene Alias: DKFZp781H1314/HNBC1/KNBC/NBC1/NBC2/SLC4A5/hhNMC/pNBC
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_003759
• Gene Symbols: SLC4A4
• Immunogen: SLC4A4 (NP_003750, 121 a.a. ∽ 229 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 8671
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only