SLC6A20, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SLC6A20.

Supplier:  Abnova Corporation H00054716A01

Catalog No. 89-106-986

Description

Transport of small hydrophilic substances across cell membranes is mediated by substrate-specific transporter proteins which have been classified into several families of related genes. The protein encoded by this gene is a member of the subgroup of transporter with unidentified substrates within the Na+ and Cl- coupled transporter family. This gene is expressed in kidney, and its alternative splicing generates 2 transcript variants. [provided by RefSeq]

Sequence: KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQ

Specifications

• Antigen: SLC6A20
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant SLC6A20.
• Gene: SLC6A20
• Gene Alias: MGC161475/SIT1/XT3/Xtrp3
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_020208
• Gene Symbols: SLC6A20
• Immunogen: SLC6A20 (NP_064593, 301 a.a. ∽ 369 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 54716
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only