Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SMAD3, Mouse, Clone: 2C12, Abnova™

Catalog No. 89104870 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-104-870 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-104-870 Supplier Abnova Corporation Supplier No. H00004088M01A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant SMAD3.

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. [provided by RefSeq]

Sequence: VCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDL

Specifications

Antigen SMAD3
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2C12
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SMAD3.
Formulation ascites with no preservative
Gene SMAD3
Gene Accession No. NM_005902
Gene Alias DKFZp586N0721/DKFZp686J10186/HSPC193/HsT17436/JV15-2/MADH3/MGC60396
Gene Symbols SMAD3
Host Species Mouse
Immunogen SMAD3 (NP_005893,120 a.a. ∽ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4088
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.