Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SMARCD3, Mouse, Clone: 1G6, Abnova™

Catalog No. 89105470 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-470 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-470 Supplier Abnova Corporation Supplier No. H00006604M01A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant SMARCD3.

The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq

Sequence: ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT

Specifications

Antigen SMARCD3
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1G6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SMARCD3.
Formulation ascites with no preservative
Gene SMARCD3
Gene Accession No. NM_001003801
Gene Alias BAF60C/CRACD3/MGC111010/Rsc6p
Gene Symbols SMARCD3
Host Species Mouse
Immunogen SMARCD3 (NP_001003801,385 a.a. ∽ 483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6604
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.