SNRPB, Mouse, Clone: 1B4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SNRPB.

Supplier:  Abnova Corporation H00006628M01A

Catalog No. 89-105-478

Description

The protein encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or snRNP structure. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding different isoforms (B and B') have been found for this gene. [provided by RefSeq]

Sequence: MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM

Specifications

• Antigen: SNRPB
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_003091
• Gene Symbols: SNRPB
• Immunogen: SNRPB (NP_003082,1 a.a. ∽ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 6628
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA
• Clone: 1B4
• Description: Mouse monoclonal antibody raised against a partial recombinant SNRPB.
• Gene: SNRPB
• Gene Alias: COD/SNRPB1/SmB/SmB'/snRNP-B
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ