SOCS2, Mouse, Clone: 3E7, Abnova™

Catalog No.	Quantity
89-105-951	200 μL

Catalog No. 89-105-951 Supplier Abnova Corporation Supplier No. H00008835M01A

Description

Mouse monoclonal antibody raised against a partial recombinant SOCS2.

This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by a subset of cytokines, including erythropoietin, GM-CSF, IL10 and interferon (IFN)-gamma. The protein encoded by this gene is found to interact with the cytoplasmic domain of insulin-like growth factor-1 receptor (IGF1R), and thus is thought to be involved in the regulation of IGF1R mediated cell signaling. Knockout studies in mice also suggested a regulatory role of this gene in IGF-1 related growth control. [provided by RefSeq

Sequence: YQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV

Specifications

• Antigen: SOCS2
• Applications: ELISA
• Classification: Monoclonal
• Clone: 3E7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SOCS2.
• Formulation: ascites with no preservative
• Gene: SOCS2
• Gene Accession No.: BC010399
• Gene Alias: CIS2/Cish2/SOCS-2/SSI-2/SSI2/STATI2
• Gene Symbols: SOCS2
• Host Species: Mouse
• Immunogen: SOCS2 (AAH10399,99 a.a. ∽ 198 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8835
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ