SPAG5, Mouse, Clone: 5F9, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SPAG5.

Supplier:  Abnova Corporation H00010615M01A

Catalog No. 89-106-369

Description

This gene encodes a protein associated with the mitotic spindle apparatus. The encoded protein may be involved in the functional and dynamic regulation of mitotic spindles. [provided by RefSeq

Sequence: AETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVDKLRVMFLEMKNEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRGCKELQGLLEF

Specifications

• Antigen: SPAG5
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC000322
• Gene Symbols: SPAG5
• Immunogen: SPAG5 (AAH00322,1082 a.a. ∽ 1191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 10615
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 5F9
• Description: Mouse monoclonal antibody raised against a partial recombinant SPAG5.
• Gene: SPAG5
• Gene Alias: DEEPEST/MAP126/hMAP126
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG3 κ