Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SPAG5, Mouse, Clone: 5F9, Abnova™

Catalog No. 89106369 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-369 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-369 Supplier Abnova Corporation Supplier No. H00010615M01A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant SPAG5.

This gene encodes a protein associated with the mitotic spindle apparatus. The encoded protein may be involved in the functional and dynamic regulation of mitotic spindles. [provided by RefSeq

Sequence: AETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVDKLRVMFLEMKNEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRGCKELQGLLEF

Specifications

Antigen SPAG5
Applications ELISA, Western Blot
Classification Monoclonal
Clone 5F9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SPAG5.
Formulation ascites with no preservative
Gene SPAG5
Gene Accession No. BC000322
Gene Alias DEEPEST/MAP126/hMAP126
Gene Symbols SPAG5
Host Species Mouse
Immunogen SPAG5 (AAH00322,1082 a.a. ∽ 1191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10615
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG3 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.