Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89107702

SPATA19, Mouse, Clone: 4A4, Abnova™

Catalog No. 89107702 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-107-702 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-107-702 Supplier Abnova Corporation Supplier No. H00219938M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant SPATA19.

Sequence: MIITTWIVYILARKGVGLPFLPITSSDIDVVESEAVSVLHHWLKKTEEEASRGIKEKLSINHPSQGVREKMSTDSPPTHGQDIHVTRDVVKHHLSKSDLLANQSQEVLEERTRIQFIRWSHTRIFQVPSEMTEDIMRDRIEQVRRSISRLTDVSAQDFSMRPSSSDC

Specifications

Antigen SPATA19
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4A4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant SPATA19.
Formulation PBS with no preservative; pH 7.4
Gene SPATA19
Gene Accession No. NM_174927.1
Gene Alias FLJ25851/SPAS1/spergen1
Gene Symbols SPATA19
Host Species Mouse
Immunogen SPATA19 (NP_777587.1,1 a.a. ∽ 167 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Protein A Purification
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 219938
Target Species Human, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.