Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89105498

SPINK1, Mouse, Clone: 4D4, Abnova™

Catalog No. 89105498 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-498 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-498 Supplier Abnova Corporation Supplier No. H00006690M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant SPINK1.

The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis. [provided by RefSeq

Sequence: DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Specifications

Antigen SPINK1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4D4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SPINK1.
Formulation ascites with no preservative
Gene SPINK1
Gene Accession No. BC025790
Gene Alias PCTT/PSTI/Spink3/TATI
Gene Symbols SPINK1
Host Species Mouse
Immunogen SPINK1 (AAH25790,24 a.a. ∽ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6690
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.