STAB2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-107-044	50 μL

Catalog No. 89-107-044 Supplier Abnova Corporation Supplier No. H00055576A01

Description

Mouse polyclonal antibody raised against a partial recombinant STAB2.

This gene encodes a large, transmembrane receptor protein which may function in angiogenesis, lymphocyte homing, cell adhesion, or receptor scavenging. The protein contains 7 fasciclin, 15 epidermal growth factor (EGF)-like, and 2 laminin-type EGF-like domains as well as a C-type lectin-like hyaluronan-binding Link module. The protein is primarily expressed on sinusoidal endothelial cells of liver, spleen, and lymph node. The receptor has been shown to bind and endocytose ligands such as hyaluronan, low density lipoprotein, Gram-positive and Gram-negative bacteria, and advanced glycosylation end products. Supporting its possible role as a scavenger receptor, the protein has been shown to cycle between the plasma membrane and lysosomes. [provided by RefSeq

Sequence: ERLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSKLGPFTVLLPTDKGLKGFNVNELLVDNKAAQYFVKLHIIAGQMNIEYMNNTDMFYTLTGKSGEIF

Specifications

• Antigen: STAB2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant STAB2.
• Formulation: 50% glycerol
• Gene: STAB2
• Gene Accession No.: NM_017564
• Gene Alias: DKFZp434E0321/FEEL-2/FELE-2/FELL/FELL-2/FEX2/HARE/STAB-2
• Gene Symbols: STAB2
• Host Species: Mouse
• Immunogen: STAB2 (NP_060034, 367 a.a. ∽ 465 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 55576
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only