STAT5A, Mouse, Clone: 1E3, Abnova™

Catalog No.	Quantity
89-105-519	200 μL

Catalog No. 89-105-519 Supplier Abnova Corporation Supplier No. H00006776M01A

Description

Mouse monoclonal antibody raised against a partial recombinant STAT5A.

The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated by, and mediates the responses of many cell ligands, such as IL2, IL3, IL7 GM-CSF, erythropoietin, thrombopoietin, and different growth hormones. Activation of this protein in myeloma and lymphoma associated with a TEL/JAK2 gene fusion is independent of cell stimulus and has been shown to be essential for the tumorigenesis. The mouse counterpart of this gene is found to induce the expression of BCL2L1/BCL-X(L), which suggests the antiapoptotic function of this gene in cells. [provided by RefSeq

Sequence: MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLE

Specifications

• Antigen: STAT5A
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1E3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant STAT5A.
• Formulation: ascites with no preservative
• Gene: STAT5A
• Gene Accession No.: BC027036
• Gene Alias: MGF/STAT5
• Gene Symbols: STAT5A
• Host Species: Mouse
• Immunogen: STAT5A (AAH27036,1 a.a. ∽ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6776
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ