STAT6, Mouse, Clone: 6C10, Abnova™

Catalog No.	Quantity
89-105-522	200 μL

Catalog No. 89-105-522 Supplier Abnova Corporation Supplier No. H00006778M01A

Description

Mouse monoclonal antibody raised against a partial recombinant STAT6.

The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. [provided by RefSeq

Sequence: PPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQD

Specifications

• Antigen: STAT6
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 6C10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant STAT6.
• Formulation: ascites with no preservative
• Gene: STAT6
• Gene Accession No.: BC004973
• Gene Alias: D12S1644/IL-4-STAT/STAT6B/STAT6C
• Gene Symbols: STAT6
• Host Species: Mouse
• Immunogen: STAT6 (NP_003144,694 a.a. ∽ 801 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6778
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2b κ