SULF1, Mouse, Clone: 1A4, Abnova™

Catalog No.	Quantity
89-106-570	200 μL

Catalog No. 89-106-570 Supplier Abnova Corporation Supplier No. H00023213M01A

Description

Mouse monoclonal antibody raised against a partial recombinant SULF1.

Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF1, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules (Dai et al., 2005 [PubMed 16192265]).[supplied by OMIM

Sequence: RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG

Specifications

• Antigen: SULF1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1A4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SULF1.
• Formulation: ascites with no preservative
• Gene: SULF1
• Gene Accession No.: NM_015170
• Gene Alias: FLJ30905/FLJ38022/FLJ41750/HSULF-1/KIAA1077/SULF-1
• Gene Symbols: SULF1
• Host Species: Mouse
• Immunogen: SULF1 (NP_055985.1,780 a.a. ∽ 871 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 23213
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ