Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SULT1B1, Mouse, Clone: 4C9, Abnova™

Catalog No. 89106763 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-763 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-763 Supplier Abnova Corporation Supplier No. H00027284M04A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant SULT1B1.

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. However, the total genomic length of this gene is greater than that of other SULT1 genes. [provided by RefSeq

Sequence: MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEK

Specifications

Antigen SULT1B1
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 4C9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SULT1B1.
Formulation ascites with no preservative
Gene SULT1B1
Gene Accession No. NM_014465
Gene Alias MGC13356/ST1B2/SULT1B2
Gene Symbols SULT1B1
Host Species Mouse
Immunogen SULT1B1 (NP_055280.2,1 a.a. ∽ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 27284
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.