SULT1B1, Mouse, Clone: 4C9, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SULT1B1.

Supplier:  Abnova Corporation H00027284M04A

Catalog No. 89-106-763

Description

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. However, the total genomic length of this gene is greater than that of other SULT1 genes. [provided by RefSeq

Sequence: MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEK

Specifications

• Antigen: SULT1B1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_014465
• Gene Symbols: SULT1B1
• Immunogen: SULT1B1 (NP_055280.2,1 a.a. ∽ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 27284
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Immunoprecipitation, Western Blot
• Clone: 4C9
• Description: Mouse monoclonal antibody raised against a partial recombinant SULT1B1.
• Gene: SULT1B1
• Gene Alias: MGC13356/ST1B2/SULT1B2
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgM κ