SUMO2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-475	50 μL

Catalog No. 89-105-475 Supplier Abnova Corporation Supplier No. H00006613A01

Description

Mouse polyclonal antibody raised against a full-length recombinant SUMO2.

This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY

Specifications

• Antigen: SUMO2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length recombinant SUMO2.
• Formulation: 50% glycerol
• Gene: SUMO2
• Gene Accession No.: BC008450
• Gene Alias: HSMT3/MGC117191/SMT3B/SMT3H2
• Gene Symbols: SUMO2
• Host Species: Mouse
• Immunogen: SUMO2 (AAH08450, 1 a.a. ∽ 95 a.a) full-length recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6613
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only