Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89106571

SYNE2, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89106571 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-571 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-571 Supplier Abnova Corporation Supplier No. H00023224A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant SYNE2.

The protein encoded by this gene is a nuclear outer membrane protein that binds cytoplasmic F-actin. This binding tethers the nucleus to the cytoskeleton and aids in the maintenance of the structural integrity of the nucleus. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: CRRELMQLEKELVERQPQVDMLQEISNSLLIKGHGEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSFDEVDSGDQPPATSVPAPRA

Specifications

Antigen SYNE2
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant SYNE2.
Formulation 50% glycerol
Gene SYNE2
Gene Accession No. NM_015180
Gene Alias DKFZp434H2235/DKFZp686E01115/DKFZp686H1931/FLJ11014/FLJ43727/FLJ45710/FLJ46790/KIAA1011/NUA/NUANCE/Nesprin-2/SYNE-2
Gene Symbols SYNE2
Host Species Mouse
Immunogen SYNE2 (NP_055995, 6702 a.a. ∽ 6799 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23224
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.