TADA2L, Mouse, Clone: S1, Abnova™

Catalog No.	Quantity
89-105-548	200 μL

Catalog No. 89-105-548 Supplier Abnova Corporation Supplier No. H00006871M01A

Description

Mouse monoclonal antibody raised against a full-length recombinant TADA2L.

Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. Two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq

Sequence: MDRLGSFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHRSDHTYEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKYFINNPLFASTLLNLKQAEEAKTADTAIPFHSTDDPPRPTFDSLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHACRWFLSLEQYLCVYIYINRRDNGVFYVKFYK

Specifications

• Antigen: TADA2L
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: S1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant TADA2L.
• Formulation: ascites with no preservative
• Gene: TADA2L
• Gene Accession No.: BC001172
• Gene Alias: ADA2/ADA2A/FLJ12705/KL04P/hADA2
• Gene Symbols: TADA2L
• Host Species: Mouse
• Immunogen: TADA2L (AAH01172,1 a.a. ∽ 305 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6871
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ