TAF5L, Mouse, Clone: 1C5, Abnova™

Catalog No.	Quantity
89-106-741	200 μL

Catalog No. 89-106-741 Supplier Abnova Corporation Supplier No. H00027097M01A

Description

Mouse monoclonal antibody raised against a partial recombinant TAF5L.

The product of this gene belongs to the WD-repeat TAF5 family of proteins. This gene encodes a protein that is a component of the PCAF histone acetylase complex. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of which are TAFs, is required for myogenic transcription and differentiation. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors to facilitate complex assembly and transcription initiation. The encoded protein is structurally similar to one of the histone-like TAFs, TAF5. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq

Sequence: MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVE

Specifications

• Antigen: TAF5L
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1C5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TAF5L.
• Formulation: ascites with no preservative
• Gene: TAF5L
• Gene Accession No.: NM_014409
• Gene Alias: PAF65B
• Gene Symbols: TAF5L
• Host Species: Mouse
• Immunogen: TAF5L (NP_055224,1 a.a. ∽ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 27097
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2b κ