TAS1R1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-107-382	50 μL

Catalog No. 89-107-382 Supplier Abnova Corporation Supplier No. H00080835A01

Description

Mouse polyclonal antibody raised against a partial recombinant TAS1R1.

The protein encoded by this gene is a G protein-coupled receptor and is a component of the heterodimeric amino acid taste receptor T1R1+3. The T1R1+3 receptor responds to L-amino acids but not to D-enantiomers or other compounds. Most amino acids that are perceived as sweet activate T1R1+3, and this activation is strictly dependent on an intact T1R1+3 heterodimer. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]

Sequence: RVFFESVVLTNLTGKVWVASEAWALSRHITGVPGIQRIGMVLGVAIQKRAVPGLKAFEEAYARADKEAPRPCHKGSWCSSNQLCRECQAFMAHTMPKLKA

Specifications

• Antigen: TAS1R1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TAS1R1.
• Formulation: 50% glycerol
• Gene: TAS1R1
• Gene Accession No.: NM_138697
• Gene Alias: GPR70/T1R1/TR1/gm148
• Gene Symbols: TAS1R1
• Host Species: Mouse
• Immunogen: TAS1R1 (NP_619642, 281 a.a. ∽ 380 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 80835
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only