TAZ, Mouse, Clone: 4A10-H3, Abnova™

Catalog No.	Quantity
89-105-555	200 μL

Catalog No. 89-105-555 Supplier Abnova Corporation Supplier No. H00006901M01A

Description

Mouse monoclonal antibody raised against a full-length recombinant TAZ.

This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known. [provided by RefSeq

Sequence: MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWAQAEAGPPGYPCPAGGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGIGRLIAECHLNPIILPLWHVGEPGDGDREMASGVGGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR

Specifications

• Antigen: TAZ
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4A10-H3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant TAZ.
• Formulation: ascites with no preservative
• Gene: TAZ
• Gene Accession No.: BC011515
• Gene Alias: BTHS/CMD3A/EFE/EFE2/FLJ27390/G4.5/LVNCX/Taz1/XAP-2
• Gene Symbols: TAZ
• Host Species: Mouse
• Immunogen: TAZ (AAH11515,1 a.a. ∽ 262 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6901
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ