Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TBX2, Mouse, Clone: 3B2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TBX2.

Manufacturer:  Abnova Corporation H00006909M02A

Catalog No. 89-105-558


Add to cart

Description

Description

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene product is the human homolog of mouse Tbx2, and shares strong sequence similarity with Drosophila omb protein. Expression studies indicate that this gene may have a potential role in tumorigenesis as an immortalizing agent. Transcript heterogeneity due to alternative polyadenylation has been noted for this gene. [provided by RefSeq

Sequence: GSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLESQRALSPGRESPK
Specifications

Specifications

TBX2
Monoclonal
Unconjugated
ascites with no preservative
NM_005994
FLJ10169
Mouse
IgG2a Kappa
RUO
Antibody
Monoclonal
Human
ELISA, Western Blot
3B2
Mouse monoclonal antibody raised against a partial recombinant TBX2.
TBX2
Ascites
TBX2
TBX2 (NP_005985,603 a.a. ∽ 702 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
200 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
6909
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit