TBX2, Mouse, Clone: 7G5, Abnova™

Catalog No.	Quantity
89-105-557	200 μL

Catalog No. 89-105-557 Supplier Abnova Corporation Supplier No. H00006909M01A

Description

Mouse monoclonal antibody raised against a partial recombinant TBX2.

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene product is the human homolog of mouse Tbx2, and shares strong sequence similarity with Drosophila omb protein. Expression studies indicate that this gene may have a potential role in tumorigenesis as an immortalizing agent. Transcript heterogeneity due to alternative polyadenylation has been noted for this gene. [provided by RefSeq

Sequence: GSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLESQRALSPGRESPK

Specifications

• Antigen: TBX2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 7G5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TBX2.
• Formulation: ascites with no preservative
• Gene: TBX2
• Gene Accession No.: NM_005994
• Gene Alias: FLJ10169
• Gene Symbols: TBX2
• Host Species: Mouse
• Immunogen: TBX2 (NP_005985,603 a.a. ∽ 702 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6909
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG3 κ