TBX3, Mouse, Clone: 3A10, Abnova™

Catalog No.	Quantity
89-105-561	200 μL

Catalog No. 89-105-561 Supplier Abnova Corporation Supplier No. H00006926M10A

Description

Mouse monoclonal antibody raised against a partial recombinant TBX3.

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined. [provided by RefSeq

Sequence: KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK

Specifications

• Antigen: TBX3
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3A10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TBX3.
• Formulation: ascites with no preservative
• Gene: TBX3
• Gene Accession No.: NM_005996
• Gene Alias: TBX3-ISO/UMS/XHL
• Gene Symbols: TBX3
• Host Species: Mouse
• Immunogen: TBX3 (NP_005987,311 a.a. ∽ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6926
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ