TCEB1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-560	50 μL

Catalog No. 89-105-560 Supplier Abnova Corporation Supplier No. H00006921A01

Description

Mouse polyclonal antibody raised against a full-length recombinant TCEB1.

This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. [provided by RefSeq

Sequence: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Specifications

• Antigen: TCEB1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length recombinant TCEB1.
• Formulation: 50% glycerol
• Gene: TCEB1
• Gene Accession No.: BC013809
• Gene Alias: SIII
• Gene Symbols: TCEB1
• Host Species: Mouse
• Immunogen: TCEB1 (AAH13809, 1 a.a. ∽ 112 a.a) full-length recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6921
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only