Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TCF7L1, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89107400 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-107-400 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-107-400 Supplier Abnova Corporation Supplier No. H00083439A01
Add to Cart
Add to Cart

Mouse polyclonal antibody raised against a partial recombinant TCF7L1.

TCF/LEF transcription factors, such as TCF7L1, are mediators of the Wnt (see MIM 164820) signaling pathway and are antagonized by the TGF-beta (TGFB1; MIM 190180) signaling pathway (Sagara and Katoh, 2000 [PubMed 11085512]).[supplied by OMIM

Sequence: PAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQPPLLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKS

Specifications

Antigen TCF7L1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant TCF7L1.
Formulation 50% glycerol
Gene TCF7L1
Gene Accession No. NM_031283
Gene Alias TCF-3/TCF3
Gene Symbols TCF7L1
Host Species Mouse
Immunogen TCF7L1 (NP_112573, 489 a.a. ∽ 586 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 83439
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.