TCIRG1, Mouse, Clone: 7H20, Abnova™

Catalog No.	Quantity
89-106-284	200 μL

Catalog No. 89-106-284 Supplier Abnova Corporation Supplier No. H00010312M02A

Description

Mouse monoclonal antibody raised against a partial recombinant TCIRG1.

Through alternate splicing, this gene encodes two proteins with similarity to subunits of the vacuolar ATPase (V-ATPase) but the encoded proteins seem to have different functions. V-ATPase is a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. V-ATPase is comprised of a cytosolic V1 domain and a transmembrane V0 domain. Mutations in this gene are associated with infantile malignant osteopetrosis. [provided by RefSeq

Sequence: QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFL

Specifications

• Antigen: TCIRG1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 7H20
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TCIRG1.
• Formulation: ascites with no preservative
• Gene: TCIRG1
• Gene Accession No.: BC018133
• Gene Alias: ATP6N1C/ATP6V0A3/Atp6i/OC-116kDa/OC116/OPTB1/Stv1/TIRC7/Vph1/a3
• Gene Symbols: TCIRG1
• Host Species: Mouse
• Immunogen: TCIRG1 (AAH18133,121 a.a. ∽ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10312
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ