TECTA, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-572	50 μL

Catalog No. 89-105-572 Supplier Abnova Corporation Supplier No. H00007007A01

Description

Mouse polyclonal antibody raised against a partial recombinant TECTA.

The tectorial membrane is an extracellular matrix of the inner ear that contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia, and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Alpha-tectorin is one of the major noncollagenous components of the tectorial membrane. Mutations in the TECTA gene have been shown to be responsible for autosomal dominant nonsyndromic hearing impairment and a recessive form of sensorineural pre-lingual nonsyndromic deafness. [provided by RefSeq

Sequence: YATPTRDSNDKLRYFIIEGGCQNLKDNTIGIEENAVSLTCRFHVTVFKFIGDYDEVHLHCAVSLCDSEKYSCKITCPHNSRIATDYTKEPKEQIISVGPI

Specifications

• Antigen: TECTA
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TECTA.
• Formulation: 50% glycerol
• Gene: TECTA
• Gene Accession No.: NM_005422
• Gene Alias: DFNA12/DFNA8/DFNB21
• Gene Symbols: TECTA
• Host Species: Mouse
• Immunogen: TECTA (NP_005413, 1981 a.a. ∽ 2080 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7007
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only